Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ICT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ICT |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ICT Polyclonal specifically detects ICT in Human samples. It is validated for Western Blot.Specifications
ICT | |
Polyclonal | |
Rabbit | |
Q14197 | |
3396 | |
Synthetic peptides corresponding to ICT1(immature colon carcinoma transcript 1) The peptide sequence was selected from the middle region of ICT1. Peptide sequence AEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Digestion substraction 1, DS-1DS1, EC 3.1.1.29, immature colon carcinoma transcript 1, Immature colon carcinoma transcript 1 protein, peptidyl-tRNA hydrolase ICT1, mitochondrial | |
ICT1 | |
IgG | |
23 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title