Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IDH3B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP21411425UL
Description
IDH3B Polyclonal specifically detects IDH3B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
IDH3B | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:2500-1:5000 | |
EC 1.1.1, EC 1.1.1.41, FLJ11043, H-IDHB, isocitrate dehydrogenase [NAD] subunit beta, mitochondrial, isocitrate dehydrogenase 3 (NAD+) beta, isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, beta subunit, Isocitric dehydrogenase subunit beta, MGC903, NAD(+)-specific ICDH subunit beta, NAD+-specific ICDH, NAD+-specific isocitrate dehydrogenase b subunit, NAD+-specific isocitrate dehydrogenase beta, RP46 | |
Rabbit | |
Affinity Purified | |
RUO | |
3420 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
IDH3B | |
This antibody was developed against a recombinant protein corresponding to the amino acids: VKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNN | |
25ul | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction