Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. IDI1 Antibody, Novus Biologicals™

IDI1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15758720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15758720 20 μL
NBP157587 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15758720 Supplier Novus Biologicals Supplier No. NBP15758720UL

Description

Rabbit Polyclonal Antibody

IDI1 Polyclonal specifically detects IDI1 in Human samples. It is validated for Western Blot.

Specifications

Antigen IDI1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q13907
Gene Alias EC 5.3.3.2, IPP isomerase 1, IPP1, IPPI1, isopentenyl diphosphate dimethylallyl diphosphate isomerase 1, Isopentenyl pyrophosphate isomerase 1, isopentenyl-diphosphate delta isomerase, isopentenyl-diphosphate delta isomerase 1, isopentenyl-diphosphate Delta-isomerase 1
Gene Symbols IDI1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to IDI1(isopentenyl-diphosphate delta isomerase 1) The peptide sequence was selected from the middle region of IDI1. Peptide sequence PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3422
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.