Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IDI1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | IDI1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15758720
|
Novus Biologicals
NBP15758720UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP157587
|
Novus Biologicals
NBP157587 |
100 μL |
Each for $487.50
|
|
|||||
Description
IDI1 Polyclonal specifically detects IDI1 in Human samples. It is validated for Western Blot.Specifications
| IDI1 | |
| Polyclonal | |
| Rabbit | |
| Q13907 | |
| 3422 | |
| Synthetic peptides corresponding to IDI1(isopentenyl-diphosphate delta isomerase 1) The peptide sequence was selected from the middle region of IDI1. Peptide sequence PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 5.3.3.2, IPP isomerase 1, IPP1, IPPI1, isopentenyl diphosphate dimethylallyl diphosphate isomerase 1, Isopentenyl pyrophosphate isomerase 1, isopentenyl-diphosphate delta isomerase, isopentenyl-diphosphate delta isomerase 1, isopentenyl-diphosphate Delta-isomerase 1 | |
| IDI1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title