Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IFIT5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15888720UL
Description
IFIT5 Polyclonal specifically detects IFIT5 in Human samples. It is validated for Western Blot.Specifications
IFIT5 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q13325 | |
IFIT5 | |
Synthetic peptides corresponding to IFIT5(interferon-induced protein with tetratricopeptide repeats 5) The peptide sequence was selected from the middle region of IFIT5. Peptide sequence ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ53857, IFIT-5, interferon-induced protein with tetratricopeptide repeats 5, Retinoic acid- and interferon-inducible 58 kDa protein, retinoic acid- and interferon-inducible protein (58kD), RI58FLJ92678 | |
Rabbit | |
Affinity Purified | |
RUO | |
24138 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction