Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IFN-alpha/beta R1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP238144
Description
IFN-alpha/beta R1 Polyclonal specifically detects IFN-alpha/beta R1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
IFN-alpha/beta R1 | |
Polyclonal | |
Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
P17181 | |
IFNAR1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: NISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV | |
0.1 mL | |
Neuroscience | |
3454 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
alpha-type antiviral protein, AVP, beta-type antiviral protein, CRF2-1, Cytokine receptor class-II member 1, Cytokine receptor family 2 member 1, human interferon-alpha receptor (HuIFN-alpha-Rec)10IFRC, IFN-alpha/beta receptor 1, IFN-alpha-REC, IFNAR, IFNBR, IFN-R-1, interferon (alpha, beta and omega) receptor 1, interferon alpha/beta receptor 1, interferon-alpha/beta receptor alpha chain, interferon-beta receptor 1, Type I interferon receptor 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction