IFN-alpha/beta R1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238144

Catalog No. NBP238144

Description

IFN-alpha/beta R1 Polyclonal specifically detects IFN-alpha/beta R1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IFN-alpha/beta R1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: P17181
• Gene Symbols: IFNAR1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV
• Quantity: 0.1 mL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 3454
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: alpha-type antiviral protein, AVP, beta-type antiviral protein, CRF2-1, Cytokine receptor class-II member 1, Cytokine receptor family 2 member 1, human interferon-alpha receptor (HuIFN-alpha-Rec)10IFRC, IFN-alpha/beta receptor 1, IFN-alpha-REC, IFNAR, IFNBR, IFN-R-1, interferon (alpha, beta and omega) receptor 1, interferon alpha/beta receptor 1, interferon-alpha/beta receptor alpha chain, interferon-beta receptor 1, Type I interferon receptor 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.