Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579441

Invitrogen™ IFNAR1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579441
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579441 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579441 Supplier Invitrogen™ Supplier No. PA579441
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human A431 whole cell, human K562 whole cell, human HEL whole cell.

Interferons are widely used therapeutic agents because of their anti tumor and antiviral effects and because of their modulatory effects on the immune system (Biron,2001, Kirkwood, 2002). These cytokines produce their effects by binding to the Type 1 Interferon-& Receptor (IFNAR1). Down regulation of this receptor plays a key role in determining the magnitude and duration of cytokine signaling. This down regulation is thought to be influenced by phosphorylation of Serine 535 and 539 in the IFNAR1 (Kumar et al., 2003).
TRUSTED_SUSTAINABILITY

Specifications

Antigen IFNAR1
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene Ifnar1
Gene Accession No. P17181
Gene Alias alpha-type antiviral protein; AVP; beta-type antiviral protein; CD118; CRF2-1; cytokine receptor class-II member 1; Cytokine receptor family 2 member 1; H3K1; Ifar; IFN R1; IFNalpha/beta R1; IFN-alpha/beta receptor 1; IFN-alpha/betaR; IFNalpha/betaR1; IFN-alpha/betaR1; IFN-alpha/betaRalpha; IFNalpha/beta-Ralpha; IFN-alpha-REC; IFNAR; Ifnar1; IFNBR; IFNR1; IFN-R-1; Ifrc; INF-a receptor; Infar; interferon (alpha and beta) receptor 1; interferon (alpha, beta and omega) receptor 1; interferon alpha and beta receptor subunit 1; interferon alpha/beta receptor 1; interferon receptor 1; interferon-alpha/beta receptor 1; interferon-alpha/beta receptor alpha chain; interferon-beta receptor 1; type I interferon receptor 1
Gene Symbols Ifnar1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human IFNAR1 (263-306aa HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLR).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3454
Target Species Human, Mouse
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.