Invitrogen™ IFNAR1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579441

Catalog No. PIPA579441

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human A431 whole cell, human K562 whole cell, human HEL whole cell.

Interferons are widely used therapeutic agents because of their anti tumor and antiviral effects and because of their modulatory effects on the immune system (Biron,2001, Kirkwood, 2002). These cytokines produce their effects by binding to the Type 1 Interferon-& Receptor (IFNAR1). Down regulation of this receptor plays a key role in determining the magnitude and duration of cytokine signaling. This down regulation is thought to be influenced by phosphorylation of Serine 535 and 539 in the IFNAR1 (Kumar et al., 2003).

Specifications

• Antigen: IFNAR1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Ifnar1
• Gene Alias: alpha-type antiviral protein; AVP; beta-type antiviral protein; CD118; CRF2-1; cytokine receptor class-II member 1; Cytokine receptor family 2 member 1; H3K1; Ifar; IFN R1; IFNalpha/beta R1; IFN-alpha/beta receptor 1; IFN-alpha/betaR; IFNalpha/betaR1; IFN-alpha/betaR1; IFN-alpha/betaRalpha; IFNalpha/beta-Ralpha; IFN-alpha-REC; IFNAR; Ifnar1; IFNBR; IFNR1; IFN-R-1; Ifrc; INF-a receptor; Infar; interferon (alpha and beta) receptor 1; interferon (alpha, beta and omega) receptor 1; interferon alpha and beta receptor subunit 1; interferon alpha/beta receptor 1; interferon receptor 1; interferon-alpha/beta receptor 1; interferon-alpha/beta receptor alpha chain; interferon-beta receptor 1; type I interferon receptor 1
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 3454
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P17181
• Gene Symbols: Ifnar1
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human IFNAR1 (263-306aa HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLR).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody
• Isotype: IgG