Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579443

Invitrogen™ IFNGR1 (CD119) Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579443
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579443 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579443 Supplier Invitrogen™ Supplier No. PA579443
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HEPG2 whole cell. Flow: SiHa cell.

This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.
TRUSTED_SUSTAINABILITY

Specifications

Antigen IFNGR1 (CD119)
Applications Flow Cytometry, Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene IFNGR1
Gene Accession No. P15260
Gene Alias antiviral protein, type 2; AVP, type 2; CD119; CD119 antigen; CDw119; Ifgr; IFN-gamma receptor 1; IFN-gammaR; IFN-gamma-R1; IFN-gamma-R-alpha; Ifngr; IFNGR1; IMD27A; IMD27B; immune interferon receptor 1; INF-g receptor; interferon gamma receptor 1; Interferon gamma receptor alpha-chain; interferon-gamma receptor 1; interferon-gamma receptor alpha chain; Nktar
Gene Symbols IFNGR1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human IFNGR1 (108-147aa QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3459
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.