IGF2BP3 Rabbit anti-Human, Mouse, Rat, Polyclonal , Abnova™

Catalog No.	Quantity
89-934-353	100 μL

Catalog No. 89-934-353 Supplier Abnova Corporation Supplier No. PAB29324

Description

Rabbit polyclonal antibody raised against recombinant human IGF2BP3.

The protein encoded by this gene is primarily found in the nucleolus, where it can bind to the 5' UTR of the insulin-like growth factor II leader 3 mRNA and may repress translation of insulin-like growth factor II during late development. The encoded protein contains several KH domains, which are important in RNA binding and are known to be involved in RNA synthesis and metabolism. A pseudogene exists on chromosome 7, and there are putative pseudogenes on other chromosomes. [provided by RefSeq]

Sequence: VVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQ

Specifications

• Antigen: IGF2BP3
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant human IGF2BP3.
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:100-1:250) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: DKFZp686F1078/IMP-3/IMP3/KOC1/VICKZ3
• Gene Symbols: IGF2BP3
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human IGF2BP3.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10643
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG