Invitrogen™ IGFBP3 Polyclonal Antibody

Catalog No.	Quantity
PIPA579451	100 μg

Catalog No. PIPA579451 Supplier Invitrogen™ Supplier No. PA579451

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat heart tissue, rat brain tissue, rat liver tissue, rat PC-12 whole cellhuman U-87MG whole cellmouse kidney tissue, mouse heart tissue, mouse brain tissue. IHC: Human Intestinal Cancer tissue.

IGFBP3 is a gene that belongs to the insulin-like growth factor binding protein (IGFBP) family. The gene encodes a protein that contains both an IGFBP domain and a thyroglobulin type-I domain. This protein is known to form a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. The complex circulates in the plasma and prolongs the half-life of IGFs while also altering their interaction with cell surface receptors. Various isoforms of the gene have been identified through alternate transcriptional splice variants. Diseases associated with IGFBP3 include Insulin-Like Growth Factor I and Acid-Labile Subunit Deficiency.

Specifications

• Antigen: IGFBP3
• Applications: ELISA, Immunohistochemistry (Paraffin), Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene: IGFBP3
• Gene Accession No.: P15473, P17936, P47878
• Gene Alias: acid stable subunit of the 140 K IGF complex; AI649005; binding protein 29; binding protein 53; BP53; BP-53; Growth hormone dependent binding protein; growth hormone-dependent binding protein; I79_011450; IBP3; IBP-3; IGF binding protein 3; IGF-binding protein 3; IGFBP; Igfbp3; IGF-BP3; IGFBP-3; IGgfbp3; Insulin like growth factor binding protein; insulin like growth factor binding protein 3; insulin-like growth factor binding protein 3; Insulin-like growth factor binding protein 3 precursor; insulin-like growth factor-binding protein (IGF-BP3); insulin-like growth factor-binding protein 3; tcag7.703
• Gene Symbols: IGFBP3
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP-3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR).
• Purification Method: Antigen affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 16009, 24484, 3486
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG