Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IGSF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | IGSF1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
IGSF1 Polyclonal specifically detects IGSF1 in Human samples. It is validated for Western Blot.Specifications
IGSF1 | |
Polyclonal | |
Rabbit | |
IGDC1Pituitary gland-specific factor 2, IgSF1, immunoglobulin superfamily member 1, immunoglobulin superfamily, member 1, Immunoglobulin-like domain-containing protein 1, InhBP, Inhibin-binding protein, KIAA0364p120, MGC75490, PGSF2IGCD1 | |
IGSF1 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
3547 | |
Synthetic peptides corresponding to IGSF1(immunoglobulin superfamily, member 1) The peptide sequence was selected from the N terminal of IGSF1. Peptide sequence WLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGEDKPLQFLDATSIDD. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title