Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IGSF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | IGSF1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159245
|
Novus Biologicals
NBP159245 |
100 μL |
Each of 1 for $436.00
|
|
Description
IGSF1 Polyclonal specifically detects IGSF1 in Human samples. It is validated for Western Blot.Specifications
IGSF1 | |
Polyclonal | |
Rabbit | |
IGDC1Pituitary gland-specific factor 2, IgSF1, immunoglobulin superfamily member 1, immunoglobulin superfamily, member 1, Immunoglobulin-like domain-containing protein 1, InhBP, Inhibin-binding protein, KIAA0364p120, MGC75490, PGSF2IGCD1 | |
IGSF1 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
3547 | |
Synthetic peptides corresponding to IGSF1(immunoglobulin superfamily, member 1) The peptide sequence was selected from the N terminal of IGSF1. Peptide sequence WLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGEDKPLQFLDATSIDD. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title