Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IGSF4B/SynCAM3/CADM3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | IGSF4B/SynCAM3/CADM3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179320
|
Novus Biologicals
NBP179320 |
100 μL |
Each of 1 for $436.00
|
|
Description
IGSF4B/SynCAM3/CADM3 Polyclonal specifically detects IGSF4B/SynCAM3/CADM3 in Human samples. It is validated for Western Blot.Specifications
IGSF4B/SynCAM3/CADM3 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
BIgR, Brain immunoglobulin receptor, cell adhesion molecule 3, IgSF4B, IGSF4BSynCAM3, Immunoglobulin superfamily member 4B, member 4B, NECL-1, NECL1TSLC1-like protein 1, Nectin-like protein 1, Synaptic cell adhesion molecule 3, synCAM3, TSLC1-like 1, TSLL1SYNCAM3 | |
CADM3 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
NP_067012 | |
57863 | |
Synthetic peptide directed towards the middle region of human CADM3The immunogen for this antibody is CADM3. Peptide sequence KDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSV. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title