Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IGSF4B/SynCAM3/CADM3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | IGSF4B/SynCAM3/CADM3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
IGSF4B/SynCAM3/CADM3 Polyclonal specifically detects IGSF4B/SynCAM3/CADM3 in Human samples. It is validated for Western Blot.Specifications
IGSF4B/SynCAM3/CADM3 | |
Polyclonal | |
Rabbit | |
NP_067012 | |
57863 | |
Synthetic peptide directed towards the middle region of human CADM3The immunogen for this antibody is CADM3. Peptide sequence KDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
BIgR, Brain immunoglobulin receptor, cell adhesion molecule 3, IgSF4B, IGSF4BSynCAM3, Immunoglobulin superfamily member 4B, member 4B, NECL-1, NECL1TSLC1-like protein 1, Nectin-like protein 1, Synaptic cell adhesion molecule 3, synCAM3, TSLC1-like 1, TSLL1SYNCAM3 | |
CADM3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title