Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ikaros/IKZF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$336.16 - $617.01
Specifications
| Antigen | Ikaros/IKZF1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Ikaros/IKZF1 Polyclonal specifically detects Ikaros/IKZF1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Ikaros/IKZF1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q13422 | |
| 10320 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKC | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Rabbit | |
| Innate Immunity | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DNA-binding protein Ikaros, hIk-1, IK1LyF-1, Ikaros (zinc finger protein), IKAROS family zinc finger 1 (Ikaros), Ikaros family zinc finger protein 1, IKAROSLymphoid transcription factor LyF-1, LYF1PRO0758, zinc finger protein, subfamily 1A, 1 (Ikaros), ZNFN1A1CLL-associated antigen KW-6 | |
| IKZF1 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title