Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IKBKB Rabbit anti-Human, Polyclonal , Abnova™

Rabbit polyclonal antibody raised against recombinant human IKBKB.

Manufacturer:  Abnova Corporation PAB29358

Catalog No. 89-934-357


Add to cart

Description

Description

NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB, MIM 604495), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM]

Sequence: PNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWH
Specifications

Specifications

IKBKB
Unconjugated
Immunohistochemistry (1:50-1:200) Immunofluorescence (1-4 ug/mL) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
Liquid
IKBKB
Recombinant protein corresponding to human IKBKB.
Antigen affinity purification
RUO
Primary
3551
Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Rabbit polyclonal antibody raised against recombinant human IKBKB.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
FLJ40509/IKK-beta/IKK2/IKKB/MGC131801/NFKBIKB
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit