Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IKIP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | IKIP |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
IKIP Polyclonal specifically detects IKIP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
IKIP | |
Polyclonal | |
Rabbit | |
Human | |
121457 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DSTLRNIRTVKRQEEEDLLRVEEQLGSDTKAIEKLEEEQHALFARDEDLTNKLSDYEPKVEECKTHLPTIESAI | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
FLJ31051, I kappa-B kinase-interacting protein, IKBKB interacting protein, IKBKB-interacting protein, IKIPI kappa B kinase interacting protein, IKK interacting protein, IKK-interacting protein, inhibitor of nuclear factor kappa-B kinase-interacting protein | |
IKBIP | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title