Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FCRL6/FcRH6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FCRL6/FcRH6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FCRL6/FcRH6 Polyclonal specifically detects FCRL6/FcRH6 in Human samples. It is validated for Western Blot.Specifications
FCRL6/FcRH6 | |
Polyclonal | |
Rabbit | |
Human | |
Fc receptor-like 6, FLJ16056 | |
FCRL6 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
NP_001004310 | |
343413 | |
Synthetic peptide directed towards the middle region of human FCRL6. Peptide sequence LRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQ. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title