Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IKZF5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $501.50
Specifications
| Antigen | IKZF5 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB18010920
|
Novus Biologicals
NBP18002120UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP180021
|
Novus Biologicals
NBP180021 |
100 μL |
Each for $501.50
|
|
|||||
Description
IKZF5 Polyclonal specifically detects IKZF5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| IKZF5 | |
| Polyclonal | |
| Rabbit | |
| NP_071911 | |
| 64376 | |
| Synthetic peptide directed towards the N terminal of human ZNFN1A5. Peptide sequence MGEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAEALQGAGTDGD. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| DKFZp781B0249, FLJ22973, IKAROS family zinc finger 5 (Pegasus), Ikaros family zinc finger protein 5, PEGASUS, zinc finger protein Pegasus, zinc finger protein, subfamily 1A, 5, zinc finger protein, subfamily 1A, 5 (Pegasus), zinc finger transcription factor Pegasus, ZNFN1A5 | |
| IKZF5 | |
| IgG | |
| 44 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title