Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-17D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | IL-17D |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
IL-17D Polyclonal specifically detects IL-17D in Human samples. It is validated for Western Blot.Specifications
IL-17D | |
Polyclonal | |
Rabbit | |
Cytokine Research | |
FLJ30846, IL-17Dinterleukin 27, IL-22, IL-27interleukin-17D, IL27interleukin-27, interleukin 17D, Interleukin-27 | |
IL17D | |
IgG | |
21 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_612141 | |
53342 | |
Synthetic peptide directed towards the N terminal of human IL17DThe immunogen for this antibody is IL17D. Peptide sequence MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGV. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title