Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-17RE Antibody (46N7E3), Alexa Fluor™ 405, Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP227367AF405
Description
IL-17RE Monoclonal specifically detects IL-17RE in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
IL-17RE | |
Monoclonal | |
Alexa Fluor 405 | |
IL-17 receptor E, interleukin 17 receptor E | |
Mouse | |
Protein G purified | |
RUO | |
132014 | |
Store at 4C in the dark. | |
IgG2b κ |
Western Blot, Immunohistochemistry (Paraffin) | |
46N7E3 | |
Western Blot, Immunohistochemistry-Paraffin | |
IL17RE | |
amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR∼TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE | |
0.1 mL | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction