Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-17RE Antibody (46N7E3), Alexa Fluor™ 532, Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP227367AF532
Description
IL-17RE Monoclonal specifically detects IL-17RE in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
IL-17RE | |
Monoclonal | |
Alexa Fluor 532 | |
50 mM sodium borate with 0.05% sodium azide | |
IL17RE | |
amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR∼TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE | |
0.1 mL | |
132014.0 | |
Store at 4°C in the dark. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
46N7E3 | |
Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin | |
IL-17 receptor E, interleukin 17 receptor E | |
Mouse | |
Protein G purified | |
Primary | |
Human | |
IgG2b κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction