Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-17RE Antibody (46N7E3), Novus Biologicals™

Mouse Monoclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP227368SS
Description
IL-17RE Monoclonal specifically detects IL-17RE in Human samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| IL-17RE | |
| Monoclonal | |
| 0.5 mg/mL | |
| Western Blot 5-10ug/ml∼, Flow Cytometry reported in scientific literature (PMID 27534549), Immunohistochemistry, Immunohistochemistry-Paraffin 10ug/ml∼ | |
| IL-17 receptor E, interleukin 17 receptor E | |
| Mouse | |
| Protein G purified | |
| RUO | |
| 132014 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG2b κ |
| Western Blot, Immunohistochemistry (Paraffin) | |
| 46N7E3 | |
| Unconjugated | |
| Q8NFR9 | |
| IL17RE | |
| amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR∼TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE | |
| 0.025 mg | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction