Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. IL-17RE Antibody (46N7E3), Novus Biologicals™

IL-17RE Antibody (46N7E3), Novus Biologicals™
SDP

Catalog No. p-4965850 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.025 mg
0.1 mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP227368SS 0.025 mg
NBP227368 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP227368SS Supplier Novus Biologicals Supplier No. NBP227368SS
Only null left
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody has been used in 1 publication

IL-17RE Monoclonal specifically detects IL-17RE in Human samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen IL-17RE
Applications Western Blot, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 46N7E3
Concentration 0.5 mg/mL
Conjugate Unconjugated
Dilution Western Blot 5-10ug/ml∼, Flow Cytometry reported in scientific literature (PMID 27534549), Immunohistochemistry, Immunohistochemistry-Paraffin 10ug/ml∼
Gene Accession No. Q8NFR9
Gene Alias IL-17 receptor E, interleukin 17 receptor E
Gene Symbols IL17RE
Host Species Mouse
Immunogen amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR∼TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Purification Method Protein G purified
Quantity 0.025 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 132014
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.