Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-17RE Antibody (46N7E3), Novus Biologicals™

Mouse Monoclonal Antibody has been used in 1 publication
$181.72 - $369.75
Specifications
| Antigen | IL-17RE |
|---|---|
| Clone | 46N7E3 |
| Concentration | 0.5 mg/mL |
| Dilution | Western Blot 5-10ug/ml∼, Flow Cytometry reported in scientific literature (PMID 27534549), Immunohistochemistry, Immunohistochemistry-Paraffin 10ug/ml∼ |
| Applications | Western Blot, Immunohistochemistry (Paraffin) |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP227368SS
![]() |
Novus Biologicals
NBP227368SS |
0.025 mg |
Each for $181.72
|
|
|||||
NBP227368
![]() |
Novus Biologicals
NBP227368 |
0.1 mg |
Each for $369.75
|
|
|||||
Description
IL-17RE Monoclonal specifically detects IL-17RE in Human samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| IL-17RE | |
| 0.5 mg/mL | |
| Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Mouse | |
| Human | |
| IL-17 receptor E, interleukin 17 receptor E | |
| IL17RE | |
| IgG2b κ | |
| Protein G purified |
| 46N7E3 | |
| Western Blot 5-10ug/ml∼, Flow Cytometry reported in scientific literature (PMID 27534549), Immunohistochemistry, Immunohistochemistry-Paraffin 10ug/ml∼ | |
| Monoclonal | |
| Purified | |
| RUO | |
| Q8NFR9 | |
| 132014 | |
| amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR∼TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title