Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IL-17RE Antibody (46N8G7), DyLight 680, Novus Biologicals™

Mouse Monoclonal Antibody

Supplier: Novus Biologicals NBP227366FR

Catalog No. NBP227366FR

$610.00 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

IL-17RE Monoclonal specifically detects IL-17RE in Human samples. It is validated for Western Blot.

Specifications

Antigen	IL-17RE
Classification	Monoclonal
Conjugate	DyLight 680
Gene Accession No.	Q8NFR9
Gene Symbols	IL17RE
Immunogen	amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR∼TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Quantity	0.1 mL
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot
Clone	46N8G7
Dilution	Western Blot
Gene Alias	IL-17 receptor E, interleukin 17 receptor E
Host Species	Mouse
Purification Method	Protein G purified
Regulatory Status	RUO
Gene ID (Entrez)	132014
Content And Storage	Store at 4C in the dark.
Isotype	IgG1 κ

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

IL-17RE Antibody (46N8G7), DyLight 680, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions