Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
-Western-Blot-NBP2-27365-img0002.jpg-650.jpg)
IL-17RE Antibody (46N8G7), Novus Biologicals™
Mouse Monoclonal Antibody
$181.90 - $366.00
Specifications
| Antigen | IL-17RE |
|---|---|
| Clone | 46N8G7 |
| Concentration | 0.5 mg/mL |
| Dilution | Western Blot 5-10ug/ml∼ |
| Applications | Western Blot |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP227365SS
|
Novus Biologicals
NBP227365SS |
0.025 mg |
Each for $181.90
|
|
|||||
|
NBP227365
|
Novus Biologicals
NBP227365 |
0.1 mg |
Each for $366.00
|
|
|||||
Description
IL-17RE Monoclonal specifically detects IL-17RE in Human samples. It is validated for Western Blot.Specifications
| IL-17RE | |
| 0.5 mg/mL | |
| Western Blot | |
| Unconjugated | |
| Mouse | |
| Human | |
| IL-17 receptor E, interleukin 17 receptor E | |
| IL17RE | |
| IgG1 κ | |
| Protein G purified |
| 46N8G7 | |
| Western Blot 5-10ug/ml∼ | |
| Monoclonal | |
| Purified | |
| RUO | |
| Q8NFR9 | |
| 132014 | |
| amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR∼TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title