Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-18 BPa/IL18BP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$254.42 - $728.30
Specifications
| Antigen | IL-18 BPa/IL18BP |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
IL-18 BPa/IL18BP Polyclonal specifically detects IL-18 BPa/IL18BP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| IL-18 BPa/IL18BP | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| O95998 | |
| 10068 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Cytokine Research, Immunology, Innate Immunity | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| IL-18BP, IL18BPa, interleukin 18 binding protein, interleukin-18-binding protein, MC51L-53L-54L homolog gene product, tadekinig-alfa | |
| IL18BP | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title