Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-2 R beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$336.16 - $691.20
Specifications
| Antigen | IL-2 R beta |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
IL-2 R beta Polyclonal specifically detects IL-2 R beta in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| IL-2 R beta | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P14784 | |
| 3560 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Immunology | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CD122, CD122 antigen, high affinity IL-2 receptor beta subunit, High affinity IL-2 receptor subunit beta, IL-2 receptor subunit beta, IL-2R subunit beta, IL-2RB, interleukin 15 receptor, beta, interleukin 2 receptor, beta, interleukin-2 receptor subunit beta, P70-75, p75 | |
| IL2RB | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title