Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-27R alpha/WSX-1/TCCR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP32136125UL
Description
IL-27R alpha/WSX-1/TCCR Polyclonal antibody specifically detects IL-27R alpha/WSX-1/TCCR in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
IL-27R alpha/WSX-1/TCCR | |
Polyclonal | |
Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
class I cytokine receptor, CRL1IL-27R, Cytokine receptor-like 1, IL27R, IL-27RA, IL-27R-alpha, interleukin 27 receptor, alpha, interleukin-27 receptor subunit alpha, TCCRIL-27 receptor subunit alpha, T-cell cytokine receptor type 1, Type I T-cell cytokine receptor, WSX-1, WSX1IL-27R subunit alpha, zcytor1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: QCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNL | |
25 μL | |
Apoptosis, Cytokine Research | |
9466 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunocytochemistry | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction