IL-28R alpha/IFN-lambda R1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169636

Catalog No. NBP169636

Description

IL-28R alpha/IFN-lambda R1 Polyclonal specifically detects IL-28R alpha/IFN-lambda R1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: IL-28R alpha/IFN-lambda R1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: class II cytokine receptor CRF2/12, CRF2/12, CRF2-12, Cytokine receptor class-II member 12, Cytokine receptor family 2 member 12, IFN-lambda receptor 1, IFN-lambda-R1, IFNLR, IFNLR1, IL-28 receptor subunit alpha, IL-28R1, IL-28RA, IL-28R-alpha, Interferon lambda receptor 1, interferon lambda, receptor 1, interleukin 28 receptor A, interleukin 28 receptor, alpha, interleukin 28 receptor, alpha (interferon, lambda receptor), interleukin or cytokine receptor 2, interleukin-28 receptor subunit alpha, LICR2, Likely interleukin or cytokine receptor 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 58 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis, Cytokine Research
• Gene ID (Entrez): 163702
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8IU57
• Gene Symbols: IFNLR1
• Immunogen: Synthetic peptides corresponding to IL28RA(interleukin 28 receptor, alpha (interferon, lambda receptor)) The peptide sequence was selected from the N terminal of IL28RA. Peptide sequence QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: alpha.
• Target Species: Human, Rat, Pig, Bovine, Equine, Rabbit
• Isotype: IgG

For Research Use Only