IL-33 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP18670225UL

Catalog No. NB431764

Description

IL-33 Polyclonal specifically detects IL-33 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IL-33
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: C9orf26chromosome 9 open reading frame 26 (NF-HEV), DKFZp586H0523, DVS27, DVS27-related protein, IL1F11, IL-1F11, IL-33, interleukin 33, Interleukin-1 family member 11, interleukin-33, NFHEV, NF-HEVNFEHEV, Nuclear factor from high endothelial venules, RP11-575C20.2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry (Paraffin), Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: IL33
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:STVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDG
• Quantity: 25 μL
• Research Discipline: Innate Immunity
• Gene ID (Entrez): 90865
• Target Species: Human
• Isotype: IgG

For Research Use Only