Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IL-5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$158.00 - $499.50

Specifications

Antigen	IL-5
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP16916320 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP16916320UL	20 μL	Each for $158.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP169163 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP169163	100 μL	Each for $499.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

IL-5 Polyclonal specifically detects IL-5 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	IL-5
Classification	Polyclonal
Host Species	Rabbit
Gene Alias	B-cell differentiation factor I, EDF, Eosinophil differentiation factor, IL-5T-cell replacing factor, interleukin 5 (colony-stimulating factor, eosinophil), interleukin-5, TRFB cell differentiation factor I
Gene Symbols	IL5
Isotype	IgG
Molecular Weight of Antigen	15 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene ID (Entrez)	3567
Immunogen	Synthetic peptides corresponding to Il5 (interleukin 5) The peptide sequence was selected from the middle region of Il5. Peptide sequence MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

IL-5 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents