Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$492.89
Specifications
| Antigen | IL-5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP169163
|
Novus Biologicals
NBP169163 |
100 μL |
Each for $492.89
|
|
|||||
|
NBP16916320
|
Novus Biologicals
NBP16916320UL |
20 μL | N/A | N/A | N/A | ||||
Description
IL-5 Polyclonal specifically detects IL-5 in Mouse samples. It is validated for Western Blot.Specifications
| IL-5 | |
| Polyclonal | |
| Rabbit | |
| B-cell differentiation factor I, EDF, Eosinophil differentiation factor, IL-5T-cell replacing factor, interleukin 5 (colony-stimulating factor, eosinophil), interleukin-5, TRFB cell differentiation factor I | |
| IL5 | |
| IgG | |
| 15 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 3567 | |
| Synthetic peptides corresponding to Il5 (interleukin 5) The peptide sequence was selected from the middle region of Il5. Peptide sequence MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title