Learn More
Abnova™ Human IL10 (P22301) Recombinant Protein
Used for Func, SDS-PAGE
Manufacturer: Abnova™ P4404
Description
The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. [provided by RefSeq]
Sequence: MSPGQGTQSENSCTHFPGNLPNmLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRNSpecifications
| P22301 | |
| Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis | |
| Lyophilized | |
| 16.6kDa | |
| Escherichia coli expression system | |
| MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN | |
| RUO | |
| CSIF|IL-10|IL10A|MGC126450|MGC126451|TGIF | |
| IL10 | |
| Escherichia coli | |
| None |
| Escherichia coli expression system | |
| Lyophilized | |
| 3586 | |
| IL10 (Human) Recombinant Protein | |
| 10 ug | |
| Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | |
| <0.1 EU/μg | |
| IL10 | |
| The activity is determined by the dose-dependant proliferation of mouse MC-9 cells and is typically less than 0.5ng/mL. | |
| Yes |
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.