Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA120693

Invitrogen™ IL21R Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA120693
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA120693 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA120693 Supplier Invitrogen™ Supplier No. PA120693
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Recommended positive controls: Mouse thymus/spleen.

The protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2 (IL2) and interleukin 5 (IL5). This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3. Knockout studies of a similar gene in mouse suggest a role for this gene in regulating immunoglobulin production. Three alternatively spliced transcript variants encoding the same protein have been described.
TRUSTED_SUSTAINABILITY

Specifications

Antigen IL21R
Applications ELISA, Flow Cytometry, Immunohistochemistry
Classification Polyclonal
Concentration 1 mg/mL
Conjugate Unconjugated
Formulation PBS with 0.1% BSA and 0.1% sodium azide
Gene Il21r
Gene Accession No. Q9JHX3
Gene Alias CD360; IL-21 receptor; Il21r; IL-21R; interleukin 21 receptor; interleukin-21 receptor; LR-beta; lymphocyte receptor beta; MGC10967; NILR; novel cytokine receptor 8; Novel interleukin receptor; NR8; UNQ3121/PRO10273
Gene Symbols Il21r
Host Species Rabbit
Immunogen Synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-terminus of mouse IL-21 receptor.
Purification Method Antigen affinity chromatography
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 60504
Target Species Mouse
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Product Type Antibody
Form Liquid
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.