Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. IMMP2L Antibody, Novus Biologicals™

IMMP2L Antibody, Novus Biologicals™
SDP

Catalog No. NBP17983820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17983820 20 μL
NBP179838 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17983820 Supplier Novus Biologicals Supplier No. NBP17983820UL

Description

Rabbit Polyclonal Antibody

IMMP2L Polyclonal specifically detects IMMP2L in Human samples. It is validated for Western Blot.

Specifications

Antigen IMMP2L
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_115938
Gene Alias EC 3.4.21, EC 3.4.21.-, IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae), IMP2 inner mitochondrial membrane protease-like (S. cerevisiae), IMP2inner mitochondrial membrane peptidase 2 like, IMP2-LIKE, IMP2-like protein, mitochondrial inner membrane protease subunit 2
Gene Symbols IMMP2L
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human IMMP2LThe immunogen for this antibody is IMMP2L. Peptide sequence LNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALE.
Molecular Weight of Antigen 20 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 83943
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.