Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IMP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	IMP3
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit
Regulatory Status	RUO

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP157229 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP157229	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

IMP3 Polyclonal specifically detects IMP3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	IMP3
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	BRMS2mitochondrial ribosomal protein S4, C15orf12, chromosome 15 open reading frame 12, FLJ10968, IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast), MRPS4DKFZp586L0118, U3 small nucleolar ribonucleoprotein protein IMP3, U3 snoRNP protein 3 homolog, U3 snoRNP protein IMP3
Gene Symbols	IMP3
Isotype	IgG

Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q9NV31
Gene ID (Entrez)	55272
Immunogen	Synthetic peptides corresponding to IMP3(IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast)) The peptide sequence was selected from the middle region of IMP3. Peptide sequence GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

IMP3 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents