Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IMP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25677425UL
Description
IMP3 Polyclonal specifically detects IMP3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
IMP3 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
BRMS2mitochondrial ribosomal protein S4, C15orf12, chromosome 15 open reading frame 12, FLJ10968, IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast), MRPS4DKFZp586L0118, U3 small nucleolar ribonucleoprotein protein IMP3, U3 snoRNP protein 3 homolog, U3 snoRNP protein IMP3 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
IMP3 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE | |
25 μL | |
DNA replication Transcription Translation and Splicing | |
55272 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction