Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Importin alpha 2/KPNA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Importin alpha 2/KPNA2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15806720
|
Novus Biologicals
NBP15806720UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP158067
|
Novus Biologicals
NBP158067 |
100 μL |
Each for $487.50
|
|
|||||
Description
Importin alpha 2/KPNA2 Polyclonal specifically detects Importin alpha 2/KPNA2 in Mouse samples. It is validated for Western Blot.Specifications
| Importin alpha 2/KPNA2 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Cellular Markers, Core ESC Like Genes, Immunology, Stem Cell Markers | |
| importin alpha 1, importin-alpha-P1, IPOA1, karyopherin alpha 2 (RAG cohort 1, importin alpha 1), Karyopherin subunit alpha-2, pendulin, QIP2importin alpha 2, RAG cohort 1, RAG cohort protein 1, RCH1importin subunit alpha-2, SRP1, SRP1alpha, SRP1-alpha | |
| KPNA2 | |
| IgG | |
| This product is specific to Subunit or Isoform: alpha-2. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P52292 | |
| 3838 | |
| Synthetic peptides corresponding to KPNA2(karyopherin alpha 2 (RAG cohort 1, importin alpha 1)) The peptide sequence was selected from the middle region of KPNA2. Peptide sequence GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title