INAVA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP190424

Catalog No. NBP190424

Description

INAVA Polyclonal specifically detects INAVA in Human samples. It is validated for Western Blot, Simple Western.

Specifications

• Antigen: C1orf106
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Simple Western 1:60, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Alias: chromosome 1 open reading frame 106, hypothetical protein LOC55765
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55765
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: C1ORF106
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PPQTLEGLQPTGPEAGSPERAPVQNSPWKETSLDHPYEKPRKSSEPWSESSSPATTPQDGPSASSLWLLEPASYHVVPIRG
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only