Indoleamine 2,3-dioxygenase/IDO Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications

Catalog Number	Mfr. No.	Quantity
NBP187702	Novus Biologicals NBP187702	0.1 mL

Description

Indoleamine 2,3-dioxygenase/IDO Polyclonal specifically detects Indoleamine 2,3-dioxygenase/IDO in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Indoleamine 2,3-dioxygenase/IDO
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: P14902
• Gene ID (Entrez): 3620
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLK
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Molecular Weight of Antigen: 45 kDa

• Dilution: Western Blot 0.04 - 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cancer
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 1.13.11.52, IDOIDO-1, INDOindole 2,3-dioxygenase, indoleamine 2,3-dioxygenase 1, indoleamine-pyrrole 2,3 dioxygenase, Indoleamine-pyrrole 2,3-dioxygenase
• Gene Symbols: IDO1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only