Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

INSL4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB169845 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB169845 100 μg
NB169846 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB169845 Supplier Novus Biologicals Supplier No. NBP317385100UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

INSL4 Polyclonal antibody specifically detects INSL4 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen INSL4
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias early placenta insulin-like peptide, EPILearly placenta insulin-like peptide (EPIL), insulin-like 4 (placenta), Insulin-like peptide 4, Placentin
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: AAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGT
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Biology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 3641
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.