Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Insulin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications
$393.50 - $658.00
Specifications
Antigen | Insulin |
---|---|
Concentration | 0.2mg/mL |
Dilution | Flow Cytometry, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
Applications | Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Description
Insulin Polyclonal specifically detects Insulin in Human samples. It is validated for Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Insulin | |
Flow Cytometry, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
Polyclonal | |
Rabbit | |
Human | |
IDDM2, ILPR, insulin, IRDN, MODY10, proinsulin | |
INS | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
0.2mg/mL | |
Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
3630 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:SHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYC | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title