Integrin alpha 2/CD49b Rabbit anti-Human, Mouse, Rat, Clone: 7O9H6, Novus Biologicals™

Rabbit Monoclonal Antibody

Supplier:  Novus Biologicals NBP315644100UL

Catalog No. NB166383

Description

Integrin alpha 2/CD49b Monoclonal antibody specifically detects Integrin alpha 2/CD49b in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown

Specifications

• Antigen: Integrin alpha 2/CD49b
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown
• Clone: 7O9H6
• Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockout Validated
• Gene Alias: alpha-2 subunit, CD49b antigen, integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor), VLA 2
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1082-1181 of human Integrin alpha 2/CD49b (P17301). GTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS
• Quantity: 100 μg
• Research Discipline: Cellular Markers, Innate Immunity, Signal Transduction
• Gene ID (Entrez): 3673
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG