Integrin alpha 3/CD49c Antibody (29A3), DyLight 680, Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP197692FR

Catalog No. NBP197692FR

Description

Integrin alpha 3/CD49c Monoclonal specifically detects Integrin alpha 3/CD49c in Human, Porcine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen.

Specifications

• Antigen: Integrin alpha 3/CD49c
• Classification: Monoclonal
• Conjugate: DyLight 680
• Formulation: 50mM Sodium Borate with 0.05% Sodium Azide
• Gene Symbols: ITGA3
• Immunogen: Clone 29A3 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: 29A3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3A. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.
• Content And Storage: Store at 4C in the dark.
• Isotype: IgG1

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
• Clone: 29A3
• Dilution: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen
• Gene Alias: antigen identified by monoclonal J143, CD49 antigen-like family member C, CD49c, CD49c antigen, FLJ34631, FLJ34704, FRP-2, Galactoprotein B3, GAP-B3, GAPB3CD49C, integrin alpha-3, integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor), MSK18, VCA-2, very late activation protein 3 receptor, alpha-3 subunit, VL3A, VLA-3 subunit alpha, VLA3a
• Host Species: Mouse
• Purification Method: Protein A or G purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3675
• Target Species: Human, Pig
• Form: Purified