Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Integrin alpha 3/CD49c Antibody (CL6937), Novus Biologicals™
SDP

Catalog No. NB402756 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB402756 25 μL
NBP276515 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB402756 Supplier Novus Biologicals Supplier No. NBP27651525UL
Only null left
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

Integrin alpha 3/CD49c Monoclonal specifically detects Integrin alpha 3/CD49c in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen Integrin alpha 3/CD49c
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Classification Monoclonal
Clone CL6937
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:100 - 1:250, Immunohistochemistry-Paraffin 1:100 - 1:250, Knockdown Validated
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Alias antigen identified by monoclonal J143, CD49 antigen-like family member C, CD49c, CD49c antigen, FLJ34631, FLJ34704, FRP-2, Galactoprotein B3, GAP-B3, GAPB3CD49C, integrin alpha-3, integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor), MSK18, VCA-2, very late activation protein 3 receptor, alpha-3 subunit, VL3A, VLA-3 subunit alpha, VLA3a
Gene Symbols ITGA3
Host Species Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: AQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEVIGV
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3675
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.