Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Integrin alpha 3B Antibody (54B3), Janelia Fluor™ 549, Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP197732JF549
Description
Integrin alpha 3B Monoclonal specifically detects Integrin alpha 3B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen.Specifications
Integrinalpha3B | |
Monoclonal | |
Janelia Fluor 549 | |
50mM Sodium Borate with 0.05% Sodium Azide | |
ITGA3 | |
Clone 54B3 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin. | |
0.1 mL | |
3675 | |
Human | |
Purified |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen) | |
54B3 | |
Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen | |
AA407068, CD49C, GAPB3, integrin alpha 3 | |
Mouse | |
Protein A or G purified | |
Primary | |
54B3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3B. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope. | |
Store at 4°C in the dark. | |
IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction