Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Integrin alpha 8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15994020UL
Description
Integrin alpha 8 Polyclonal specifically detects Integrin alpha 8 in Human samples. It is validated for Western Blot.Specifications
Integrin alpha 8 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P53708 | |
ITGA8 | |
Synthetic peptides corresponding to ITGA8(integrin, alpha 8) The peptide sequence was selected from the N terminal of ITGA8. Peptide sequence GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
integrin alpha-8, integrin, alpha 8 | |
Rabbit | |
Affinity Purified | |
RUO | |
8516 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction