Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Integrin alpha E/CD103 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Integrin alpha E/CD103 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. p-7248466 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB169051 25 μg
NB169050 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB169051 Supplier Novus Biologicals Supplier No. NBP31698725UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Integrin alpha E/CD103 Polyclonal antibody specifically detects Integrin alpha E/CD103 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen Integrin alpha E/CD103
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide, CD103, CD103 antigen, HML-1 antigen, HUMINAE, integrin alpha-E, Integrin alpha-IEL, integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alphapolypeptide), MGC141996, Mucosal lymphocyte 1 antigen
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GGAPFVLSSLLHQDPSTNQTWLLVTSPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNK
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 3682
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.