Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Inversin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310988100UL
Description
Inversin Polyclonal specifically detects Inversin in Human samples. It is validated for Western Blot.Specifications
Inversin | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
inversin, Inversion of embryo turning homolog, INVMGC133081, KIAA0573, MGC133080, nephrocystin 2, nephrocystin-2, nephronophthisis 2 (infantile), NPH2, NPHP2inversion of embryonic turning | |
The immunogen is a synthetic peptide directed towards the C terminal region of human Inversin (NP_055240). Peptide sequence ALLKAGADVNKTDHSQRTALHLAAQKGNYRFMKLLLTRRANWMQKDLEEM | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
27130 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title