Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Involucrin Rabbit anti-Human, Mouse, Rat, Clone: 8H7B3, Novus Biologicals™

Rabbit Monoclonal Antibody
$205.50 - $494.50
Specifications
Antigen | Involucrin |
---|---|
Clone | 8H7B3 |
Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Monoclonal |
Description
Involucrin Monoclonal antibody specifically detects Involucrin in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
Involucrin | |
Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
Monoclonal | |
Purified | |
RUO | |
Human, Mouse, Rat | |
involucrin | |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Involucrin (P07476). KAENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKEQLLELPEQQEGHLKHLEQQEGQLKHPEQQEGQLELPEQQEGQLELPEQQE | |
Primary | |
Store at -20°C. Avoid freeze-thaw cycles. |
8H7B3 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Extracellular Matrix | |
PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
3713 | |
IgG | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title