Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IP3KC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP24897525UL
Description
IP3KC Polyclonal antibody specifically detects IP3KC in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
IP3KC | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
inositol 14,5-trisphosphate 3-kinase CIP3K C, inositol-trisphosphate 3-kinase C, InsP 3 kinase C, InsP 3-kinase C, IP3 3-kinase C, IP3-3KC, IP3KCEC 2.7.1.127 | |
This antibody was developed against a recombinant protein corresponding to amino acids: KSWADNLWTHQNSSSLQTHPEGACPSKEPSADGSWKELYTDGSRTQQDIEGPWTEPYTDGSQKKQDTEAARKQ | |
25 μL | |
Primary | |
Human | |
Purified |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
80271 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction